Recombinant human CD11c/Integrin alpha X protein

Name: Recombinant human CD11c/Integrin alpha X protein
Brand: Proteintech
SKU: Ag11380

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Liquid

Cat no : Ag11380

Synonyms

CD11C; SLEB6

Validation Data Gallery View All

CD11c/Integrin alpha X fusion protein Ag11380 SDS-PAGE

-/ -

Cat No. Ag11380

Freight/Packing: -

Country/Region

Size

Quantity

Please visit your regions distributor:

Request bulk or custom quote

Product Information

Peptide Sequence	NLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMA (21-352 aa encoded by BC038237)
Activity	Not tested.
Endotoxin Level	Please contact the lab for more information.
Formulation	The protein was expressed as GST-tagged fusion protein by E.Coli and purified by Glutathione-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 100mM GSH.

Shipping and Storage

Reconstitution	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping	The product is shipped with ice packs. Upon receipt, store it immediately at -20°C to -80°C.
Stability and Storage	Aliquot and store at -20°C to -80°C for up to 6 months. Avoid freeze thaw cycles.
Storage of Reconstituted Protein	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.

Recombinant human CD11c/Integrin alpha X protein

Validation Data Gallery View All

CD11c/Integrin alpha X fusion protein Ag11380 SDS-PAGE

Product Information

Shipping and Storage

Related Products

CD11c/Integrin Alpha X Polyclonal antibody

CD11c/Integrin alpha X Recombinant antibody

FITC Plus Anti-Human CD11c (BU15)

Anti-Human CD11c (3.9)

CoraLite® Plus 488 Anti-Human CD11c (3.9)

CoraLite® Plus 488-conjugated CD11c/Integrin Alpha X Monoclonal antibody

CoraLite®594-conjugated CD11c/Integrin Alpha X Monoclonal antibody

CoraLite®594 Anti-Human CD11c (BU15)

MultiPro® 5CFLX Anti-Human CD11c (3.9)

Anti-Human CD11c (BU15) Mouse IgG2a Recombinant Antibody

FITC Plus Anti-Human CD11c (3.9)

PE Anti-Human CD11c (3.9)

CD11c/Integrin alpha X Recombinant antibody, PBS Only

CoraLite® Plus 750 Anti-Human CD11c (3.9)

FITC Plus Anti-Human CD11c (3.9) Mouse IgG1 Recombinant Antibody

CoraLite®594-conjugated CD11c/Integrin alpha X Recombinant antibody

CoraLite® Plus 647 Anti-Human CD11c (3.9) Mouse IgG2a Recombinant Antibody

Atlantic Blue™ Anti-Human CD11c (3.9)

CoraLite® Plus 488 Anti-Human CD11c (3.9) Mouse IgG2a Recombinant Antibody

PE Anti-Human CD11c (BU15)

CoraLite® Plus 750 Anti-Human CD11c (BU15)

Cardinal Red™ Anti-Human CD11c (3.9)

Cardinal Red™ Anti-Human CD11c (BU15)

Anti-Human CD11c (3.9) Mouse IgG2a Recombinant Antibody

Anti-Human CD11c (3.9) Mouse IgG2a Recombinant Antibody, PBS Only

CoraLite® Plus 647 Anti-Human CD11c (3.9) Mouse IgG1 Recombinant Antibody

CoraLite® Plus 647 Anti-Human CD11c (BU15) Mouse IgG2a Recombinant Antibody

CoraLite® Plus 488 Anti-Human CD11c (BU15)

CoraLite® Plus 488 Anti-Human CD11c (BU15) Mouse IgG2a Recombinant Antibody

CoraLite® Plus 555 Anti-Human CD11c (3.9)

CoraLite® Plus 555 Anti-Human CD11c (BU15)

CoraLite® Plus 647 Anti-Human CD11c (3.9)

CoraLite® Plus 647 Anti-Human CD11c (BU15)

CoraLite® Plus 405 Anti-Human CD11c (3.9)

CoraLite® Plus 405 Anti-Human CD11c (BU15)

Atlantic Blue™ Anti-Human CD11c (BU15)

APC Anti-Human CD11c (3.9)

CD11c/Integrin Alpha X Monoclonal antibody

CD11c/Integrin Alpha X Monoclonal antibody, PBS Only

Anti-Human CD11c (BU15)

Anti-Human CD11c (3.9) Mouse IgG1 Recombinant Antibody

Anti-Human CD11c (3.9) Mouse IgG1 Recombinant Antibody, PBS Only