CD8A Fusion Protein

Name: mouse CD8A-6*His fusion protein
Brand: Proteintech
SKU: Ag31942

Source

e coli.-derived, PET28a

Tag

6*His

Format

Liquid

Cat no : Ag31942

Synonyms

Validation Data Gallery View All

CD8A fusion protein Ag31942 SDS-PAGE

-/ -

Cat No. Ag31942

Freight/Packing: -

Country/Region

Size

Quantity

Please visit your regions distributor:

Request bulk or custom quote

Product Information

Peptide Sequence	KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY (28-196 aa encoded by NM_001081110)
Activity	Not tested.
Endotoxin Level	Please contact the lab for more information.
Formulation	The protein was expressed as 6xHis-tagged fusion protein by E.Coli and purified by Ni-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 300mM imidazole.

Shipping and Storage

Reconstitution	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping	The product is shipped with ice packs. Upon receipt, store it immediately at -20°C to -80°C.
Stability and Storage	Aliquot and store at -20°C to -80°C for up to 6 months. Avoid freeze thaw cycles.
Storage of Reconstituted Protein	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.

CD8A Fusion Protein

Validation Data Gallery View All

CD8A fusion protein Ag31942 SDS-PAGE

Product Information

Shipping and Storage

Related Products

CoraLite®594 Anti-Mouse CD8a (53-6.7)

CoraLite® Plus 647 Anti-Mouse CD8a (53-6.7)

CoraLite® Plus 750 Anti-Mouse CD8a (5H10-1)

Anti-Mouse CD8a (53-6.7)

CoraLite®594 Anti-Mouse CD8a (5H10-1)

CoraLite® Plus 647 Anti-Mouse CD8a (5H10-1)

Anti-Mouse CD8a (5H10-1)

CoraLite® Plus 750 Anti-Mouse CD8a (53-6.7)

CD8a Polyclonal antibody

CoraLite® Plus 488 Anti-Mouse CD8a (53-6.7)

CoraLite® Plus 488 Anti-Mouse CD8a (5H10-1)

PE Anti-Mouse CD8a (53-6.7)

PE Anti-Mouse CD8a (5H10-1)

CoraLite® Plus 555 Anti-Mouse CD8a (53-6.7)

CoraLite® Plus 555 Anti-Mouse CD8a (5H10-1)

FITC Plus Anti-Mouse CD8a (53-6.7)

FITC Plus Anti-Mouse CD8a (5H10-1)

PerCP Anti-Mouse CD8a (53-6.7)

PerCP-Cyanine5.5 Anti-Mouse CD8a (53-6.7)

APC Anti-Mouse CD8a (5H10-1)

CoraLite® Plus 405 Anti-Mouse CD8a (53-6.7)

CoraLite® Plus 405 Anti-Mouse CD8a (5H10-1)

Atlantic Blue™ Anti-Mouse CD8a (53-6.7)

Atlantic Blue™ Anti-Mouse CD8a (5H10-1)

APC Anti-Mouse CD8a (53-6.7)