Tested Applications
| Positive WB detected in | mouse spleen tissue, mouse thymus tissue |
| Positive IF-Fro detected in | mouse spleen tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29896-1-AP targets CD8a in WB, IF-Fro, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31942 Product name: Recombinant mouse CD8A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 28-196 aa of NM_001081110 Sequence: KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY Predict reactive species |
| Full Name | CD8 antigen, alpha chain |
| Calculated Molecular Weight | 27KD |
| Observed Molecular Weight | 32-35 kDa |
| GenBank Accession Number | NM_001081110 |
| Gene Symbol | Cd8a |
| Gene ID (NCBI) | 12525 |
| RRID | AB_2935485 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01731 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 is composed of two disulfide-linked chains and can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells , on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-/CD8+ T cells (PMID: 1968084).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD8a antibody 29896-1-AP | Download protocol |
| WB protocol for CD8a antibody 29896-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
29896-1-AP is a Rabbit anti-CD8a polyclonal antibody with 49 total citations. Publications appear in journals including Signal Transduction and Targeted Therapy, Advanced Materials, ACS Nano, Neuron, Cell Death & Differentiation, Biomaterials, Journal of Controlled Release, Nature Precision Oncology, Journal of Translational Medicine, and Frontiers in Immunology. Research fields encompass cancer immunotherapy, tumor microenvironment, nanomedicine, hepatocellular carcinoma, melanoma, pancreatic cancer, glioblastoma, breast cancer, gastric cancer, ovarian cancer, esophageal cancer, and neuroimmunology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Krüppel-like factor 4 downregulation during esophageal cancer formation facilitates immune evasion and impairs immunotherapy | ||
Adv Mater Inhalable Respiratory Driven Penetration of Porous Microsphere-Based Mucosal Vaccine for Long-Term Immune Protection. | ||
ACS Nano Remodeling of Effector and Regulatory T Cells by Capture and Utilization of miRNAs Using Nanocomposite Hydrogel for Tumor-Specific Photothermal Immunotherapy | ||
Neuron A peritumoral microenvironment engaged by Reg-EXTL3 axis fosters nerve-cancer interactions in pancreatic ductal adenocarcinoma. | ||
J Nanobiotechnology Oxygen-delivery nanoparticles enhanced immunotherapy efficacy monitored by granzyme B PET imaging in malignant tumors | ||
J Exp Clin Cancer Res Regnase-1 downregulation promotes pancreatic cancer through myeloid-derived suppressor cell-mediated evasion of anticancer immunity |
