Biotin-conjugated Beta Actin Monoclonal antibody

Beta Actin Monoclonal Antibody for IHC
Cat No. Biotin-60008
Clone No.7D2C10

Host / Isotype

Mouse / IgM

Reactivity

human, mouse, rat, pig, plant, Zebrafish

Applications

WB, IHC

ACTB, Actin, actin, beta, Actin, cytoplasmic 1, B actin, Beta actin, Cell and organelle markers, Cytoskeleton Marker, F actin, PS1TP5BP1, β actin

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 4 publications below

Product Information

Biotin-60008 targets Beta Actin in WB, IHC applications and shows reactivity with human, mouse, rat, pig, plant, Zebrafish samples.

Tested Reactivity human, mouse, rat, pig, plant, Zebrafish
Cited Reactivityhuman, rat, pig
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0297

Product name: Recombinant human beta actin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 14-167 aa of BC002409

Sequence: SGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE

Predict reactive species
Full Name actin, beta
Calculated Molecular Weight 375 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC002409
Gene Symbol Beta Actin
Gene ID (NCBI) 60
RRIDAB_2883062
Conjugate Biotin
FormLiquid
Purification MethodCaprylic acid/ammonium sulfate precipitation
UNIPROT IDP60709
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Beta actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody can recognize all the actins.

Protocols

Product Specific Protocols
IHC protocol for Biotin Beta Actin antibody Biotin-60008Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

iScience

The vesicular transporter STX11 governs ATGL-mediated hepatic lipolysis and lipophagy.

Authors - Gaojian Zhang
pigWB

Reproduction

FSH promotes immature porcine Sertoli cell proliferation by activating the CCR7/Ras-ERK signaling axis

Authors - Yanfei Yin
ratWB

Exp Ther Med

Deciphering the role of TNF‑α‑induced protein 8‑like 2 in the pathogenesis of necrotizing enterocolitis in neonatal rats

Authors - Juan Luo
humanWB

Balkan Med J

Asiaticoside Down-Regulates HIF-1α to Inhibit Proliferation, Migration, and Angiogenesis in Thyroid Cancer Cells

Authors - Yi Zhang
Loading...
||
New chat Able
正在加载,请稍候...