Filter:
  • Western Blot (WB) analysis of various lysates using Lamin B1 Monoclonal antibody (66095-1-Ig)

    WB analysis using 66095-1-Ig

    Various lysates were subjected to SDS PAGE followed by western blot with 66095-1-Ig (Lamin B1 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of multi-cells/tissue using Lamin B1 Monoclonal antibody (66095-1-Ig)

    WB analysis of multi-cells/tissue using 66095-1-Ig

    Western blot on multiple cells/tissues with anti-LMNB1 (66095-1-Ig) at dilution 1:20000.

  • Western Blot (WB) analysis of HeLa cells using Lamin B1 Monoclonal antibody (66095-1-Ig)

    WB analysis of HeLa using 66095-1-Ig

    WB result of Lamin B1 antibody (66095-1-Ig; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Lamin B1 transfected HeLa cells.

  • Immunoprecipitation (IP) experiment of HeLa cells using Lamin B1 Monoclonal antibody (66095-1-Ig)

    IP experiment of HeLa using 66095-1-Ig

    IP result of anti-Lamin B1 (IP:66095-1-Ig, 4ug; Detection:66095-1-Ig 1:20000) with HeLa cells lysate 3560ug.

  • Immunohistochemistry (IHC) staining of human pancreas cancer tissue using Lamin B1 Monoclonal antibody (66095-1-Ig)

    IHC staining of human pancreas cancer using 66095-1-Ig

    Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66095-1-Ig (Lamin B1 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human pancreas cancer tissue using Lamin B1 Monoclonal antibody (66095-1-Ig)

    IHC staining of human pancreas cancer using 66095-1-Ig

    Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66095-1-Ig (Lamin B1 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human breast cancer tissue using Lamin B1 Monoclonal antibody (66095-1-Ig)

    IHC staining of human breast cancer using 66095-1-Ig

    Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66095-1-Ig (Lamin B1 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of mouse eye tissue using Lamin B1 Monoclonal antibody (66095-1-Ig)

    IF Staining of mouse eye using 66095-1-Ig

    Immunofluorescent analysis of (4% PFA) fixed mouse eye tissue using Lamin B1 antibody (66095-1-Ig, Clone: 3C10G12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using Lamin B1 Monoclonal antibody (66095-1-Ig)

    IF Staining of HepG2 using 66095-1-Ig

    Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 66095-1-Ig (Lamin B1 antibody) at dilution of 1:500 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using Lamin B1 Monoclonal antibody (66095-1-Ig)

    IF Staining of HeLa using 66095-1-Ig

    Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 66095-1-Ig (Lamin B1 antibody) at dilution of 1:200 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  • Flow cytometry (FC) experiment of HeLa cells using Lamin B1 Monoclonal antibody (66095-1-Ig)

    FC experiment of HeLa using 66095-1-Ig

    1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human Lamin B1 (66095-1-Ig, Clone:3C10G12) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

"Lamin B1 Antibodies" Comparison

View side-by-side comparison of Lamin B1 antibodies from other vendors to find the one that best suits your research needs.
  • Featured Product
  • KD/KO Validated

Lamin B1 Monoclonal antibody

Lamin B1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

Cat No. 66095-1-Ig
Clone No.3C10G12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA

LMNB1, 3C10G12, laminB1, Lamin-B1, LMN2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNCI-H1299 cells, multi-cells/tissue, HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, PC-12 cells, NIH/3T3 cells, 4T1cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman pancreas cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse eye tissue
Positive IF/ICC detected inHepG2 cells, HeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66095-1-Ig targets Lamin B1 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit, canine, chicken, zebrafish, bovine, hamster
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20522

Product name: Recombinant human Lamin B1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 237-587 aa of BC012295

Sequence: EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

Predict reactive species
Full Name lamin B1
Calculated Molecular Weight 66 kDa
Observed Molecular Weight 66-70 kDa
GenBank Accession NumberBC012295
Gene Symbol Lamin B1
Gene ID (NCBI) 4001
ENSEMBL Gene IDENSG00000113368
RRIDAB_11232208
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP20700
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. This protein is not suitable for samples where the nuclear envelope has been removed.

Protocols

Product Specific Protocols
WB protocol for Lamin B1 antibody 66095-1-IgDownload protocol
IHC protocol for Lamin B1 antibody 66095-1-IgDownload protocol
IF protocol for Lamin B1 antibody 66095-1-IgDownload protocol
IP protocol for Lamin B1 antibody 66095-1-IgDownload protocol
FC protocol for Lamin B1 antibody 66095-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Nat Cell Biol

Ceramide-rich microdomains facilitate nuclear envelope budding for non-conventional exosome formation.

Authors - Subhash B Arya

J Hepatol

OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism.

Authors - Weiqi Dai

Cell Rep Med

Management of prostate cancer by targeting 3βHSD1 after enzalutamide and abiraterone treatment.

Authors - Zejie Mei
humanWB

Nat Commun

ARF1 prevents aberrant type I interferon induction by regulating STING activation and recycling

Authors - Maximilian Hirschenberger
humanWB

Nat Commun

FOXP3+ regulatory T cell perturbation mediated by the IFNγ-STAT1-IFITM3 feedback loop is essential for anti-tumor immunity

Authors - Xinnan Liu
humanWB

J Clin Invest

FAM117B promotes gastric cancer growth and drug resistance by targeting the KEAP1/NRF2 signaling pathway

Authors - Yunjiang Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Echo (Verified Customer) (10-03-2024)

Quality great

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: HEK293T
Lamin B1 Antibody Western Blot validation (1:5000 dilution) in HEK293T (Cat no:66095-1-Ig)
FH

PK (Verified Customer) (08-14-2024)

Excellent

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: AC16
Lamin B1 Antibody Western Blot validation (1000 dilution) in AC16 (Cat no:66095-1-Ig)
FH

S (Verified Customer) (12-12-2022)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: LUNG Fibroblast
Lamin B1 Antibody Western Blot validation (1000 dilution) in LUNG Fibroblast (Cat no:66095-1-Ig)
FH

WEI (Verified Customer) (03-08-2022)

Specfic bands around predicted size with higher non-specific bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse Heart
FH

P. (Verified Customer) (05-15-2021)

Good antibody!

  • Applications: Western Blot
  • Cell Tissue Type: H9C2
Lamin B1 Antibody Western Blot validation ( dilution) in H9C2 (Cat no:66095-1-Ig)
FH

Eiko (Verified Customer) (11-18-2020)

Used RIPA buffer for western sample preparation, and 5% Skim milk TBS-T was used for blocking and antibody dilution.Since I could see clear lamin B1 signal, I am happy to use this antibody as one of my internal controls.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000 (can be more diluted)
  • Cell Tissue Type: hTERT-RPE1
FH

Tom (Verified Customer) (10-09-2020)

I observed a discrete ~70kDa Lamin B1 band using this antibody.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Yuan (Verified Customer) (12-13-2019)

Did staining for human A549 cell.The Lamin B antibody had high background in nucleus. Please see attached image.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Human A549 cell
Lamin B1 Antibody Immunofluorescence, validation (1:250 dilution) in Human A549 cell (Cat no:66095-1-Ig)
FH

Shubham (Verified Customer) (03-14-2019)

good

  • Applications: Western Blot,
  • Cell Tissue Type: AC16
Lamin B1 Antibody Western Blot, validation ( dilution) in AC16 (Cat no:66095-1-Ig)
Loading...