Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 3 publications below |
Product Information
CL594-66095 targets Lamin B1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20522 Product name: Recombinant human Lamin B1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 237-587 aa of BC012295 Sequence: EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM Predict reactive species |
| Full Name | lamin B1 |
| Calculated Molecular Weight | 66 kDa |
| GenBank Accession Number | BC012295 |
| Gene Symbol | Lamin B1 |
| Gene ID (NCBI) | 4001 |
| ENSEMBL Gene ID | ENSG00000113368 |
| RRID | AB_2883510 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P20700 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. This protein is not suitable for samples where the nuclear envelope has been removed. The antibody is conjugated with CL594, Ex/Em 593 nm/614 nm.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL594 Lamin B1 antibody CL594-66095 | Download protocol |
| IF protocol for CL594 Lamin B1 antibody CL594-66095 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Redox Biol MG53 protein rejuvenates hUC-MSCs and facilitates their therapeutic effects in AD mice by activating Nrf2 signaling pathway. | ||
Mol Oncol Small extracellular vesicles deliver TGF-β1 and promote adriamycin resistance in breast cancer cells. | ||
bioRxiv Replicative senescence is ATM driven, reversible, and accelerated by hyperactivation of ATM at normoxia |



