Tested Applications
| Positive IF-P detected in | mouse testis tissue |
| Positive IF-Fro detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL555-17178 targets TNP1 in IF-P, IF-Fro applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10890 Product name: Recombinant human TNP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-55 aa of BC029516 Sequence: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL Predict reactive species |
| Full Name | transition protein 1 (during histone to protamine replacement) |
| Calculated Molecular Weight | 55 aa, 7 kDa |
| Observed Molecular Weight | 6-10 kDa |
| GenBank Accession Number | BC029516 |
| Gene Symbol | TNP1 |
| Gene ID (NCBI) | 7141 |
| RRID | AB_2919633 |
| Conjugate | CoraLite®555 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 557 nm / 570 nm |
| Excitation Laser | Green Laser (532 nm), Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09430 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Transition nuclear proteins (TNP1 and TNP2) are the major nuclear proteins that replace somatic histones during spermatogenesis. TNPs are required for normal chromatin condensation and functional sperm development, spermatogenesis was found to be compromised in both Tnp1 and Tnp2 null mice. TNP1, or TP1, localized in nucleus, is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines. Recently, TNP-1 was used as a germ cell marker in condensing spermatids.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL555 TNP1 antibody CL555-17178 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



