• Featured Product
  • KD/KO Validated

SOX9 Monoclonal antibody, PBS Only

SOX9 Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 67439-1-PBS
Clone No.1H9A6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

1H9A6, CMD1, CMPD1, SRA1, Transcription factor SOX 9

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67439-1-PBS targets SOX9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28620

Product name: Recombinant human SOX9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 209-509 aa of BC007951

Sequence: ADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP

Predict reactive species
Full Name SRY (sex determining region Y)-box 9
Calculated Molecular Weight 509 aa, 56 kDa
Observed Molecular Weight 56 kDa
GenBank Accession NumberBC007951
Gene Symbol SOX9
Gene ID (NCBI) 6662
RRIDAB_2882675
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP48436
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining region Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor.

Loading...
||
New chat Able
正在加载,请稍候...