Tested Applications
Positive WB detected in | HT-29 cells, Caco-2 cells, human placenta tissue, NCCIT cells |
Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 67 publications below |
Product Information
67439-1-Ig targets SOX9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat, pig, rabbit, canine |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28620 Product name: Recombinant human SOX9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 209-509 aa of BC007951 Sequence: ADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP Predict reactive species |
Full Name | SRY (sex determining region Y)-box 9 |
Calculated Molecular Weight | 509 aa, 56 kDa |
Observed Molecular Weight | 56 kDa |
GenBank Accession Number | BC007951 |
Gene Symbol | SOX9 |
Gene ID (NCBI) | 6662 |
RRID | AB_2882675 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P48436 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining region Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SOX9 antibody 67439-1-Ig | Download protocol |
IHC protocol for SOX9 antibody 67439-1-Ig | Download protocol |
FC protocol for SOX9 antibody 67439-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Bioact Mater Synergizing adaptive immunity and regenerative signals to enhance osteochondral defects repair | ||
Sci Transl Med Single-cell atlas of human infrapatellar fat pad and synovium implicates APOE signaling in osteoarthritis pathology | ||
Adv Sci (Weinh) Mechanical Load-Induced Upregulation of Talin2 through Non-Canonical Deubiquitination of OTUB1 Drives Facet Joint Osteoarthritis Pathogenesis | ||
Theranostics Histone H3K27 methyltransferase EZH2 regulates apoptotic and inflammatory responses in sepsis-induced AKI | ||
Mater Today Bio Platelet-derived extracellular vesicles ameliorate intervertebral disc degeneration by alleviating mitochondrial dysfunction | ||
Stem Cell Res Ther Tremella polysaccharide microneedles loaded with magnetic dental pulp stem cell intracellular vesicles used for androgenic alopecia |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Iram (Verified Customer) (09-18-2025) | Very good antibody for IB, IHC and IF.
|
FH Agustina (Verified Customer) (09-13-2025) | With this dilution the cells included as positive control (PC3 cells) had a good signal, however not much in the PDXs, even though it seems some was there (could be related with decalcification or other sample processing steps). I will try increasing the antibody concentration.
|