CoraLite® Plus 647-conjugated MITF Polyclonal antibody

• 

  FC experiment of Jurkat using CL647-13092

  1X10^6 Jurkat cells were intracellularly stained with 0.2 ug CoraLite® Plus 647 Anti-Human MITF (CL647-13092) (red), or 0.2 ug CL647-30000 Rabbit IgG (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

MITF Polyclonal Antibody for FC (Intra)

Cat No. CL647-13092

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

WS2A, Microphthalmia-associated transcription factor, MI, Class E basic helix-loop-helix protein 32, bHLHe32

---

Tested Applications

• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-13092 targets MITF in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3679

  Product name: Recombinant human MITF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-91 aa of BC012503

  Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ

• Full Name: microphthalmia-associated transcription factor
• Calculated Molecular Weight: 91 aa, 10 kDa, 59 kDa
• Observed Molecular Weight: 59-65 kDa
• GenBank Accession Number: BC012503
• Gene Symbol: MITF
• Gene ID (NCBI): 4286
• RRID: AB_2934879
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75030
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The retinal pigment epithelium (RPE) has a essential role in maintaining visual function and dedifferentiation of RPE contributes to the pathophysiology of several ocular diseases[PMID: 22523078]. Microphthalmia-associated transcription factor (MITF) is a key regulator of RPE differentiation that is also down-regulated in dedifferentiated hfRPE cells. MITF is a basic helix-loop-helix (hHLH)-leucine zipper protein that involves in the development of various cell types, including neural crest-derived melanocytes and optic cup-derived retinal pigment epithelial cells [PMID: 10578055].