CoraLite® Plus 647-conjugated MEK6 Polyclonal antibody

• 

  FC experiment of HeLa using CL647-12745

  1X10^6 HeLa cells were intracellularly stained with 0.2 ug CoraLite® Plus 647 Anti-Human MEK6 (CL647-12745) (red), or 0.2 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

MEK6 Polyclonal Antibody for FC (Intra)

Cat No. CL647-12745

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra)

Synonyms

MAP2K6, MKK6, MAPKK 6, MAPK/ERK kinase 6, MAP kinase kinase 6

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-12745 targets MEK6 in FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3706

  Product name: Recombinant human MAP2K6 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-334 aa of BC012009

  Sequence: MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

• Full Name: mitogen-activated protein kinase kinase 6
• Calculated Molecular Weight: 334 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC012009
• Gene Symbol: MEK6
• Gene ID (NCBI): 5608
• RRID: AB_2934874
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52564
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MAPKK6 (Dual specificity mitogen activated protein kinase kinase 6), also known as MAP2K6 / MEK6 / MKK6, is a member of MAPKK protein kinase family. MKK6 plays an important role in intracellular signaling pathways leading toward activation of the p38 MAP kinase. MEK6 phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. MEK6 plays a complex role in cancer, with some evidence showing it can promote tumor growth. Overexpression of MEK6 has been linked to decreased survival in lung adenocarcinoma, breast cancer, and melanoma.