CoraLite® Plus 488-conjugated MEK6 Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-12745

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 MEK6 antibody (CL488-12745) at dilution of 1:200.

• 

  FC experiment of HepG2 using CL488-12745

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human MEK6 (CL488-12745) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

MEK6 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-12745

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Synonyms

MAP2K6, MKK6, MAPKK 6, MAPK/ERK kinase 6, MAP kinase kinase 6

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

CL488-12745 targets MEK6 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3706

  Product name: Recombinant human MAP2K6 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-334 aa of BC012009

  Sequence: MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

• Full Name: mitogen-activated protein kinase kinase 6
• Calculated Molecular Weight: 334 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC012009
• Gene Symbol: MEK6
• Gene ID (NCBI): 5608
• RRID: AB_2919059
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52564
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MAPKK6 (Dual specificity mitogen activated protein kinase kinase 6), also known as MAP2K6 / MEK6 / MKK6, is a member of MAPKK protein kinase family. MKK6 plays an important role in intracellular signaling pathways leading toward activation of the p38 MAP kinase. MEK6 phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. MEK6 plays a complex role in cancer, with some evidence showing it can promote tumor growth. Overexpression of MEK6 has been linked to decreased survival in lung adenocarcinoma, breast cancer, and melanoma.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Adv Biol (Weinh); Single-Cell RNA Transcriptome of the Human Endometrium Reveals Epithelial Characterizations Associated with Recurrent Implantation Failure; Authors - Hong Zhang