CoraLite®555-conjugated MEK6 Polyclonal antibody

• 

  IF Staining of HepG2 using CL555-12745

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite®555 MEK6 antibody (CL555-12745) at dilution of 1:200.

• Featured Product
• KD/KO Validated

MEK6 Polyclonal Antibody for IF/ICC

Cat No. CL555-12745

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

MAP kinase kinase 6, MAP2K6, MAPK/ERK kinase 6, MAPKK 6, MAPKK6, MEK 6, MEK6, MKK6, PRKMK6, SAPKK3

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL555-12745 targets MEK6 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3706

  Product name: Recombinant human MAP2K6 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-334 aa of BC012009

  Sequence: MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

• Full Name: mitogen-activated protein kinase kinase 6
• Calculated Molecular Weight: 334 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC012009
• Gene Symbol: MEK6
• Gene ID (NCBI): 5608
• RRID: AB_2919612
• Conjugate: CoraLite®555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 557 nm / 570nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52564
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.