WIF1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67904-1-Ig (same clone as 67904-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67904-1-Ig (WIF1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67904-1-PBS in a different storage buffer formulation.

WIF1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67904-1-PBS

Clone No.2G6A3

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

WIF 1, WIF1, WNT inhibitory factor 1

---

Product Information

67904-1-PBS targets WIF1 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23972

  Product name: Recombinant human WIF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-180 aa of BC018037

  Sequence: MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQA

• Full Name: WNT inhibitory factor 1
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC018037
• Gene Symbol: WIF1
• Gene ID (NCBI): 11197
• RRID: AB_2918660
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y5W5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.