CoraLite® Plus 488-conjugated TWIST2 Monoclonal antibody

TWIST2 Monoclonal Antibody for IF/ICC
Cat No. CL488-66544
Clone No.1B12D11

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, mouse

Applications

IF/ICC

bHLHa39, Dermis expressed protein 1, Dermo 1, DERMO1, twist homolog 2 (Drosophila), Twist related protein 2, TWIST2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66544 targets TWIST2 in IF/ICC applications and shows reactivity with Human, rat, mouse samples.

Tested Reactivity Human, rat, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2348

Product name: Recombinant human TWIST2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-160 aa of BC033168

Sequence: MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH

Predict reactive species
Full Name twist homolog 2 (Drosophila)
Calculated Molecular Weight 160 aa, 18 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC033168
Gene Symbol TWIST2
Gene ID (NCBI) 117581
RRIDAB_2919341
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8WVJ9
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TWIST2, also named as BHLHA39 and DERMO1,is a basic helix-loop-helix protein which acts as a transcriptional regulator, plays a central role in differentiation of mesodermal during embryogenesis. TWIST2 inhibits the premature or ectopic differentiation of preosteoblast cells during osteogenesis, possibly by changing the internal signal transduction response of osteoblasts to external growth factors. It is also implicated in tumorigenesis, invasion and metastasis. TWIST2 forms both homodimers(45KD) and heterodimers with E2A E proteins, and dimer partner selection is a critical mediator of TWIST function. (PMID:14724576, 16502419).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TWIST2 antibody CL488-66544Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...