CoraLite® Plus 647-conjugated TMEM119 Polyclonal antibody

TMEM119 Polyclonal Antibody for IF-P, FC (Intra)
Cat No. CL647-27585

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P, FC (Intra)

UNQ731/PRO1415, transmembrane protein 119, Osteoblast induction factor, OBIF

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse liver tissue
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-27585 targets TMEM119 in IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26269

Product name: Recombinant human TMEM119 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 119-218 aa of NM_181724

Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE

Predict reactive species
Full Name transmembrane protein 119
Calculated Molecular Weight 29 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberNM_181724
Gene Symbol TMEM119
Gene ID (NCBI) 338773
RRIDAB_3673571
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ4V9L6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#27585-1-AP. The predicted MW of TMEM119 is 29 kDa. Catalog#27585-1-AP recognizes 45-50 kDa band may due to glycosylation..

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 TMEM119 antibody CL647-27585Download protocol
FC protocol for CL Plus 647 TMEM119 antibody CL647-27585Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...