Tested Applications
| Positive WB detected in | K-562 cells |
Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL750-60281 targets SECTM1 in WB applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgM |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14645 Product name: Recombinant human SECTM1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 29-248 aa of BC017716 Sequence: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP Predict reactive species |
| Full Name | secreted and transmembrane 1 |
| Calculated Molecular Weight | 248 aa, 27 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC017716 |
| Gene Symbol | SECTM1 |
| Gene ID (NCBI) | 6398 |
| Conjugate | CoraLite® Plus 750 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 755 nm / 780 nm |
| Form | Liquid |
| Purification Method | Thiophilic affinity chromatograph |
| UNIPROT ID | Q8WVN6 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SECTM1, also named as protein K12, is originally identified by its location just upstream of the CD7 locus. It has been proposed as a ligand for CD7. SECTM1 is involved in thymocyte signaling. This antibody is specific to SECTM1.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CL Plus 750 SECTM1 antibody CL750-60281 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

