SECTM1 Monoclonal antibody

• 

  WB analysis using 60281-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60281-1-Ig (SECTM1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  IHC staining of human breast cancer using 60281-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60281-1-Ig (SECTM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 60281-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60281-1-Ig (SECTM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 60281-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60281-1-Ig (SECTM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SECTM1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60281-1-Ig

Clone No.1C11B4

Publications(1)

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

K12, Protein K 12, secreted and transmembrane 1, SECTM1

---

Tested Applications

• Positive WB detected in: HaCaT cells, JAR cells, NCCIT cells, PC-3 cells, LNCaP cells, HeLa cells, K-562 cells
• Positive IHC detected in: human breast cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

60281-1-Ig targets SECTM1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14645

  Product name: Recombinant human SECTM1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 29-248 aa of BC017716

  Sequence: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP

• Full Name: secreted and transmembrane 1
• Calculated Molecular Weight: 248 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC017716
• Gene Symbol: SECTM1
• Gene ID (NCBI): 6398
• RRID: AB_2881399
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Thiophilic affinity chromatograph
• UNIPROT ID: Q8WVN6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SECTM1, also named as protein K12, is originally identified by its location just upstream of the CD7 locus. It has been proposed as a ligand for CD7. SECTM1 is involved in thymocyte signaling. This antibody is specific to SECTM1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	iScience; SECTM1 is upregulated in immuno-hot tumors and predicts immunotherapeutic efficacy in multiple cancers; Authors - Jie Mei