SECTM1 Monoclonal antibody

SECTM1 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 60281-1-Ig
Clone No.1C11B4

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

WB, IHC, ELISA

K12, Protein K 12, secreted and transmembrane 1, SECTM1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHaCaT cells, JAR cells, NCCIT cells, PC-3 cells, LNCaP cells, HeLa cells, K-562 cells
Positive IHC detected inhuman breast cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60281-1-Ig targets SECTM1 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14645

Product name: Recombinant human SECTM1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 29-248 aa of BC017716

Sequence: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP

Predict reactive species
Full Name secreted and transmembrane 1
Calculated Molecular Weight 248 aa, 27 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC017716
Gene Symbol SECTM1
Gene ID (NCBI) 6398
RRIDAB_2881399
Conjugate Unconjugated
FormLiquid
Purification MethodThiophilic affinity chromatograph
UNIPROT IDQ8WVN6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SECTM1, also named as protein K12, is originally identified by its location just upstream of the CD7 locus. It has been proposed as a ligand for CD7. SECTM1 is involved in thymocyte signaling. This antibody is specific to SECTM1.

Protocols

Product Specific Protocols
FC protocol for SECTM1 antibody 60281-1-IgDownload protocol
IHC protocol for SECTM1 antibody 60281-1-IgDownload protocol
WB protocol for SECTM1 antibody 60281-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

iScience

SECTM1 is upregulated in immuno-hot tumors and predicts immunotherapeutic efficacy in multiple cancers

Authors - Jie Mei
Loading...
||
New chat Able
正在加载,请稍候...