• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Podocalyxin Polyclonal antibody

Podocalyxin Polyclonal Antibody for IF-P
Cat No. CL594-18150

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P

GCTM 2 antigen, Gp200, PC, PCLP, PCLP 1, PCLP1, Podocalyxin, podocalyxin like, Podocalyxin like protein 1, PODXL, RCC marker, TRA 1 81,TRA 1 60

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman kidney tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-18150 targets Podocalyxin in IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12844

Product name: Recombinant human TRA-1-60 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 23-428 aa of BC093730

Sequence: SPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSM

Predict reactive species
Full Name podocalyxin-like
Calculated Molecular Weight 526 aa, 55 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC093730
Gene Symbol Podocalyxin
Gene ID (NCBI) 5420
RRIDAB_2919846
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00592
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Podocalyxin, also known as podocalyxin-like protein 1 (PODXL or PCLP1), is a transmembrane glycoprotein belonging to the CD34 family of sialomucins. Podocalyxin was originally identified as the major sialoprotein on podocytes of the kidney glomerulus, but was later found to be expressed on vascular endothelial cells and early hematopoietic progenitors. It Involved in the regulation of both adhesion and cell morphology. In addition, podocalyxin is highly expressed in embryonic stem cells and aberrant expression of podocalyxin has been implicated in a wide range of cancers. Podocalyxin is a protein with a peptide bone of ∼55.5 kDa that undergoes a post‐translational glycosylation, the different molecular mass of podocalyxin indicates the extent and variability of glycosylation patterns (PMID: 17092254).

Protocols

Product Specific Protocols
IF protocol for CL594 Podocalyxin antibody CL594-18150Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...