• Featured Product
  • KD/KO Validated

Podocalyxin Polyclonal antibody

Podocalyxin Polyclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 18150-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF-P, ELISA

PODXL, GCTM 2 antigen, GCTM-2 antigen, Gp200, PC

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman kidney tissue, HEK-293 cells, HepG2 cells
Positive IHC detected inhuman kidney tissue, human endometrial cancer tissue, human lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman kidney tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:500-1:4000
Immunofluorescence (IF)-PIF-P : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18150-1-AP targets Podocalyxin in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12844

Product name: Recombinant human TRA-1-60 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 23-428 aa of BC093730

Sequence: SPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSM

Predict reactive species
Full Name podocalyxin-like
Calculated Molecular Weight 526 aa, 55 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC093730
Gene Symbol Podocalyxin
Gene ID (NCBI) 5420
RRIDAB_11044193
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00592
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Podocalyxin, also known as podocalyxin-like protein 1 (PODXL or PCLP1), is a transmembrane glycoprotein belonging to the CD34 family of sialomucins. Podocalyxin was originally identified as the major sialoprotein on podocytes of the kidney glomerulus but was later found to be expressed on vascular endothelial cells and early hematopoietic progenitors. It is involved in the regulation of both adhesion and cell morphology. In addition, podocalyxin is highly expressed in embryonic stem cells and aberrant expression of podocalyxin has been implicated in a wide range of cancers. Podocalyxin is a protein with a peptide bone of ∼55.5 kDa that undergoes a post‐translational glycosylation, the different molecular mass of podocalyxin indicates the extent and variability of glycosylation patterns (PMID: 17092254).

Protocols

Product Specific Protocols
IF protocol for Podocalyxin antibody 18150-1-APDownload protocol
IHC protocol for Podocalyxin antibody 18150-1-APDownload protocol
WB protocol for Podocalyxin antibody 18150-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Kidney Int

Quantitative assessment of glomerular basement membrane collagen IV α chains in paraffin sections from patients with focal segmental glomerulosclerosis and Alport gene variants

Authors - Pongpratch Puapatanakul
humanWB

Int J Mol Sci

Identification of Overexpressed Genes in Malignant Pleural Mesothelioma.

Authors - Federica Morani

Dis Model Mech

Ascorbate protects human kidney organoids from damage induced by cell-free hemoglobin

Authors - Julie Bejoy
humanIF

Tissue Eng Part A

Genome engineering of human urine-derived stem cells to express lactoferrin and deoxyribonuclease

Authors - Zara Kenigsberg
WB

Int J Cardiol

Brg1 deficiency in vascular endothelial cells blocks neutrophil recruitment and ameliorates cardiac ischemia-reperfusion injury in mice.

Authors - Xinjian Zhang
human

Sci Rep

Urinary extracellular vesicles and micro-RNA as markers of acute kidney injury after cardiac surgery.

Authors - Douglas Miller
Loading...
||
New chat Able
正在加载,请稍候...