• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated NRAS Polyclonal antibody

NRAS Polyclonal Antibody for FC (Intra)
Cat No. CL647-10724

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

HRAS1, EC:3.6.5.2, GTPase NRas, N ras, NRAS1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-10724 targets NRAS in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1081

Product name: Recombinant human NRAS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-189 aa of BC005219

Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM

Predict reactive species
Full Name neuroblastoma RAS viral (v-ras) oncogene homolog
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC005219
Gene Symbol NRAS
Gene ID (NCBI) 4893
RRIDAB_2934834
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01111
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NRAS, also named as N-ras and NRAS1, is neuroblastoma RAS viral (v-ras) oncogene homolog from the mammalian ras gene family and it is a member of the small GTPase superfamily. RAS proteins are involved in signal transduction pathways, and bind GDP/GTP and possess intrinsic GTPase activity. It is mapped on chromosome 1, and it is activated in HL60, a promyelocytic leukemia line. Defects in NRAS are a cause of juvenile myelomonocytic leukemia (JMML).

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 NRAS antibody CL647-10724Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...