Tested Applications
| Positive WB detected in | A431 cells, C6 cells, NIH/3T3 cells, Jurkat cells, A549 cells, HEK-293 cells, MCF-7 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human pancreas tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10724-1-AP targets NRAS in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1081 Product name: Recombinant human NRAS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC005219 Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM Predict reactive species |
| Full Name | neuroblastoma RAS viral (v-ras) oncogene homolog |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 21 kDa |
| GenBank Accession Number | BC005219 |
| Gene Symbol | NRAS |
| Gene ID (NCBI) | 4893 |
| RRID | AB_2154209 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01111 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neuroblastoma rat sarcoma viral oncogene homolog (NRAS) was originally identified as the third RAS family member following KRAS and HRAS in human neuroblastoma and fibrosarcoma cell lines (PMID: 6572964). Akin to KRAS, NRAS encodes small GTP enzymes which regulate cell cycle, proliferation, maturation and differentiation by transducing signals from membrane-localized receptor tyrosine kinases to the nucleus. The mutation of RAS gene family occurs in nearly 30% of human cancers (PMID: 12509763). NRAS plays an important role in EGFR mediating RAS/RAF/MEK/ERK and PI3K/AKT/mTOR signaling pathways (PMID: 17297468). The mutation of NRAS leads to continuous activation of Ras-GTP, which promotes tumorigenesis and metastasis. It has been proved that NRAS acts as a negative prognosis predictor in numerous somatic malignancies, such as melanoma, colorectal cancer and hepatocellular carcinoma (PMID: 30685691, PMID: 30484984). Besides, NRAS, as a proto-oncogene, is also proved to be associated with tumor immune microenvironment (TIM) both in vivo and in vitro. NRAS GTPase is related to T-cell proliferation and immune response (PMID: 34746975). NRAS, also named as N-ras and NRAS1, is neuroblastoma RAS viral (v-ras) oncogene homolog from the mammalian ras gene family and it is a member of the small GTPase superfamily. RAS proteins are involved in signal transduction pathways, and bind GDP/GTP and possess intrinsic GTPase activity. It is mapped on chromosome 1, and it is activated in HL60, a promyelocytic leukemia line. Defects in NRAS are a cause of juvenile myelomonocytic leukemia (JMML).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NRAS antibody 10724-1-AP | Download protocol |
| IF protocol for NRAS antibody 10724-1-AP | Download protocol |
| IHC protocol for NRAS antibody 10724-1-AP | Download protocol |
| IP protocol for NRAS antibody 10724-1-AP | Download protocol |
| WB protocol for NRAS antibody 10724-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Cell A non-canonical role for a small nucleolar RNA in ribosome biogenesis and senescence | ||
Nat Aging Nuclear export of R-loop by the DDX1 and XPO1 complex promotes senescence-associated secretory phenotype and inflammaging | ||
Gut RNA helicase DDX5 enables STAT1 mRNA translation and interferon signalling in hepatitis B virus replicating hepatocytes. | ||
Nat Cell Biol ADAR1 downregulation by autophagy drives senescence independently of RNA editing by enhancing p16INK4a levels. | ||
Cancer Res Mutant and Wild-Type RAS Cross-talk and Stoichiometric Deficiencies Are Determinants of Sensitivity to Targeted Therapies in KRASG12R Pancreatic Ductal Adenocarcinoma. | ||
Cancer Res Combined Inhibition of HRAS and MEK Induces Tumor Regression and Restores Myogenic Differentiation in HRAS-Mutant Rhabdomyosarcoma. |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
RAFAEL (Verified Customer) (03-18-2026) | The antibody is not entirely specific, as it recognizes other Ras isoforms such as KRAS
 |
Brandon (Verified Customer) (11-27-2018) | Worked excellent on mouse tissue from inducible tumor model!
|
