CoraLite® Plus 488-conjugated HNRNPD Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-12770

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 HNRNPD antibody (CL488-12770) at dilution of 1:200, CL594-Phalloidin (red).

• 

  FC experiment of HepG2 using CL488-12770

  1x10^6 HepG2 cells were intracellularly stained with 0.8 ug Coralite® Plus 488 HNRNPD Polyclonal Antibody (CL488-12770)(red), or 0.8 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

HNRNPD Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-12770

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

AUF1, HNRPD, hnRNPD0, hnRNP D0, AU-rich element RNA-binding protein 1

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-12770 targets HNRNPD in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3458

  Product name: Recombinant human HNRNPD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC026015

  Sequence: MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY

• Full Name: heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)
• Calculated Molecular Weight: 355 aa, 38 kDa
• Observed Molecular Weight: 38-45 kDa
• GenBank Accession Number: BC026015
• Gene Symbol: HNRNPD
• Gene ID (NCBI): 3184
• RRID: AB_3672548
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q14103
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. HNRNPD, also known as AUF1, belongs to the family of AU-binding proteins (AU-BPs) that regulate the cellular half-lives of many mRNAs by directly interacting with an AU-rich element (ARE) located in their 3′ untranslated region [PMID:8578590,12704645]. AUF1 has four isoforms produced by alternative splicing of a single transcript: p37, p40, p42, and p45 (PMID:9521873).