Product Information
67286-1-PBS targets Glucagon in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag10629 Product name: Recombinant human Glucagon protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-180 aa of BC005278 Sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK Predict reactive species | 
                                    
| Full Name | glucagon | 
| Calculated Molecular Weight | 180 aa, 21 kDa | 
| GenBank Accession Number | BC005278 | 
| Gene Symbol | Glucagon | 
| Gene ID (NCBI) | 2641 | 
| RRID | AB_2882552 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | P01275 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 
Background Information
Glucagon is a 29-amino acid peptide hormone secreted from the pancreatic alpha cells with a powerful stimulatory effect on hepatic glucose production acting to increase plasma glucose levels. Glucagon is best known as the counter-regulatory hormone to INS, and normal glucose homeostasis depends largely on the balanced secretion of INS and glucagon from the pancreatic beta and alpha cells, respectively.The regulation of glucose metabolism by glucagon is mediated by its direct action on the peripheral tissues such as the liver and also by the brain. Glucagon is also released postprandially in a transient manner, which was shown to be involved in inhibition of food intake via reduction of meal size.















