CoraLite®594-conjugated GFP tag Monoclonal antibody

GFP tag Monoclonal Antibody for WB, IF/ICC

Cat No. CL594-66002
Clone No.1E10H7

Host / Isotype

Mouse / IgG2a

Reactivity

recombinant protein

Applications

WB, IF/ICC

eGFP, GFP, green, GFP-tag, eYFP

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRecombinant protein
Positive IF/ICC detected inTransfected HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66002 targets GFP tag in WB, IF/ICC applications and shows reactivity with recombinant protein samples.

Tested Reactivity recombinant protein
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2128

Product name: Recombinant aequorea victoria GFP tag protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-238 aa of M62653

Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Predict reactive species
Full Name GFP tag
Calculated Molecular Weight 26 kDa
GenBank Accession NumberM62653
Gene Symbol
Gene ID (NCBI)
RRIDAB_2919937
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42212
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Green Fluorescent Proteins (GFPs) encompass a diverse range of proteins carrying a green chromophore, originating from various species and forming different protein lineages. 

Wildtype GFP consists of 238 amino acid residues (26.9 kDa). GFP was first identified in the jellyfish Aequorea victoria. It emits green light with a peak wavelength of 509 nm upon excitation by blue light at 395 nm.

When fused with other proteins, GFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.

This antibody is a mouse (IgG2a) monoclonal antibody against GFP reactive to GFP, eGFP, eYFP, YFP and CFP. This antibody is labeled with CoraLite Plus 594.



Protocols

Product Specific Protocols
IF protocol for CL594 GFP tag antibody CL594-66002Download protocol
WB protocol for CL594 GFP tag antibody CL594-66002Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...