• Featured Product
  • KD/KO Validated

Fibronectin Monoclonal antibody

Fibronectin Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA
Cat No. 66042-1-Ig
Clone No.1G10F9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA, Cell treatment

FN1, 1G10F9, Anastellin, CIG, Cold insoluble globulin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma tissue, human plasma, rat serum, HuH-7 cells, HepG2 cells, MG-63 cells, U2OS cells
Positive IP detected inhuman plasma tissue
Positive IHC detected inhuman colon cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman colon cancer tissue
Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66042-1-Ig targets Fibronectin in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine, sheep
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8016

Product name: Recombinant human FN1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 2177-2386 aa of BC005858

Sequence: DQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE

Predict reactive species
Full Name fibronectin 1
Calculated Molecular Weight 2386 aa, 263 kDa
Observed Molecular Weight 263 kDa
GenBank Accession NumberBC005858
Gene Symbol Fibronectin
Gene ID (NCBI) 2335
RRIDAB_11182385
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02751
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibronectin 1 (FN1) is a high molecular weight glycoprotein which exists in both a soluble form in plasma (plasma FN1) and other body fluids and an insoluble form in the extracellular matrix (cellular FN1). Plasma FN1 (dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. FN1 binds to cell surfaces through integrins and to various compounds including collagen, fibrin and heparin. It is involved in cell adhesion and migration processes including embryogenesis, wound healing, hemostasis, host defense, and metastasis. (PMID: 7276612; 12244123; 12847088)

Protocols

Product Specific Protocols
IF protocol for Fibronectin antibody 66042-1-IgDownload protocol
IHC protocol for Fibronectin antibody 66042-1-IgDownload protocol
IP protocol for Fibronectin antibody 66042-1-IgDownload protocol
WB protocol for Fibronectin antibody 66042-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Protein Cell

Neutrophil extracellular traps license macrophage production of chemokines to facilitate CD8+ T cell infiltration in obstruction-induced renal fibrosis

Authors - Hongshuai Jia
humanIF

Dev Cell

Vimentin intermediate filaments coordinate actin stress fibers and podosomes to determine the extracellular matrix degradation by macrophages

Authors - Xinyi Huang
ratWB,IF

Int J Biol Macromol

A multifunctional polydopamine/genipin/alendronate nanoparticle licences fibrin hydrogels osteoinductive and immunomodulatory potencies for repairing bone defects

Authors - Wentao Shi
humanWB,IF

Biomed Pharmacother

Nintedanib prevents TGF-β2-induced epithelial-mesenchymal transition in retinal pigment epithelial cells

Authors - Yiwei Yin
mouseIHC

Oxid Med Cell Longev

HBO1 as an Important Target for the Treatment of CCL4-Induced Liver Fibrosis and Aged-Related Liver Aging and Fibrosis

Authors - Baopeng Xing
mouseIHC

Front Immunol

Integrated analysis reveals crosstalk between pyroptosis and immune regulation in renal fibrosis

Authors - Fengxia Bai

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Udesh (Verified Customer) (04-19-2023)

Worked well for IP, band seen just below 250 kD (page ruler plus ladder). Lower band is light chain IgG

  • Applications: Western Blot, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: BM-MSCs
Fibronectin Antibody Western Blot,Immunoprecipitation validation (1:1000 dilution) in BM-MSCs (Cat no:66042-1-Ig)
FH

Ren Jie (Verified Customer) (07-11-2022)

Quite significant smear and non-specific binding

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human imortalized mammary fibroblast
Fibronectin Antibody Western Blot validation (1:1000 dilution) in Human imortalized mammary fibroblast (Cat no:66042-1-Ig)
FH

Deqiang (Verified Customer) (05-14-2020)

it works well on mouse embryo paraffin sections.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
FH

Jihyun (Verified Customer) (05-07-2020)

There is no background signal. I can get a good one band in the WB. Great!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse epithelial cell
Loading...
||
New chat

Able

正在加载,请稍候...