• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Cyclin D1 Monoclonal antibody

Cyclin D1 Monoclonal Antibody for FC (Intra)
Cat No. CL488-60186
Clone No.2G3G5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

FC (Intra)

B cell lymphoma 1 protein, CCND1, cyclin D, cyclin D1, D11S287E, G1/S specific cyclin D1, PRAD1, PRAD1 oncogene, U21B31

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inSH-SY5Y cells
Positive FC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60186 targets Cyclin D1 in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0689

Product name: Recombinant human Cyclin D1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 65-245 aa of BC000076

Sequence: LEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLR

Predict reactive species
Full Name cyclin D1
Calculated Molecular Weight 295 aa, 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC000076
Gene Symbol Cyclin D1
Gene ID (NCBI) 595
RRIDAB_2923749
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP24385
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CCND1 (cyclin D1), also known as PRAD1 or BCL1, belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. CCND1 forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. The CCND1 gene, located on 11q13 has been reported to be overexpressed in mantle cell lymphoma (MCL) due to the chromosomal translocation. CCND1 has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Over-expression of CCND1 is known to correlate with the early onset of cancer and risk of tumor progression and metastasis.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Cyclin D1 antibody CL488-60186Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...