CRX Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 67555-1-Ig (same clone as 67555-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67555-1-Ig (CRX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67555-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Y79 using 67555-1-Ig (same clone as 67555-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 67555-1-Ig (CRX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67555-1-PBS in a different storage buffer formulation.

• 

  Sample test of MP51402-2

  Sample test of MP51402-2, CRX Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67555-1-PBS. Detection antibody: 67555-4-PBS.

• 

  IHC staining of mouse eye using 67555-1-Ig (same clone as 67555-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 67555-1-Ig (CRX antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67555-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP51402-2

  Cytometric bead array standard curve of MP51402-2, CRX Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67555-1-PBS. Detection antibody: 67555-4-PBS. Standard:Ag30086. Range: 0.098-100 ng/mL.

CRX Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA, Sample test

Cat No. 67555-1-PBS

Clone No.1C3C11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Cytometric bead array, Indirect ELISA, Sample test

Synonyms

1C3C11, cone rod homeobox, Cone-rod homeobox protein, CORD2, CRD

---

Product Information

67555-1-PBS targets CRX as part of a matched antibody pair:

MP51402-2: 67555-1-PBS capture and 67555-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30086

  Product name: Recombinant human CRX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 166-285 aa of BC016664

  Sequence: ASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFKDPTGTWKFTYNPMDP

• Full Name: cone-rod homeobox
• Calculated Molecular Weight: 299 aa, 32 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC016664
• Gene Symbol: CRX
• Gene ID (NCBI): 1406
• RRID: AB_2882769
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43186
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cone-rod homeobox (Crx) is a homeodomain transcription factor and member of the Otx family, which has been thought to play a critical role in determining and maintaining the phenotype of both pinealocytes and retinal photoreceptors [PMID:17467693]. In the mammalian retina, Crx plays an essential role in the normal development and maintenance of cones and rods and regulates expression of the network of genes that characterize the retina [PMID:17653270]. Elimination of Crx by disruption of the homeobox domain results in loss of the image-forming visual system but not the non-image-forming visual system controlling circadian rhythms [PMID:20438719].