Tested Applications
| Positive WB detected in | rat retina tissue, Y79 cells, mouse retina tissue, pig retina tissue | 
| Positive IHC detected in | mouse eye tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 | 
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67555-1-Ig targets CRX in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.
| Tested Reactivity | Human, mouse, rat, pig | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag30086 Product name: Recombinant human CRX protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 166-285 aa of BC016664 Sequence: ASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFKDPTGTWKFTYNPMDP Predict reactive species | 
                                    
| Full Name | cone-rod homeobox | 
| Calculated Molecular Weight | 299 aa, 32 kDa | 
| Observed Molecular Weight | 37 kDa | 
| GenBank Accession Number | BC016664 | 
| Gene Symbol | CRX | 
| Gene ID (NCBI) | 1406 | 
| RRID | AB_2882769 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | O43186 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Cone-rod homeobox (Crx) is a homeodomain transcription factor and member of the Otx family, which has been thought to play a critical role in determining and maintaining the phenotype of both pinealocytes and retinal photoreceptors [PMID:17467693]. In the mammalian retina, Crx plays an essential role in the normal development and maintenance of cones and rods and regulates expression of the network of genes that characterize the retina [PMID:17653270]. Elimination of Crx by disruption of the homeobox domain results in loss of the image-forming visual system but not the non-image-forming visual system controlling circadian rhythms [PMID:20438719].
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CRX antibody 67555-1-Ig | Download protocol | 
| WB protocol for CRX antibody 67555-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Alessandro (Verified Customer) (02-04-2025)  | high specificity and sensitivity, providing reliable and reproducible results 
  | 





