CoraLite® Plus 488-conjugated CDX2 Recombinant monoclonal antibody

CDX2 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-82659
Clone No.3J1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

CDX-2, CDX 3, Caudal-type homeobox protein 2, Caudal type homeobox protein 2, Caudal type homeobox 2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inCaco-2 cells, HepG2 cells
Positive FC (Intra) detected inCaco-2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82659 targets CDX2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17310

Product name: Recombinant human CDX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-180 aa of BC014461

Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ

Predict reactive species
Full Name caudal type homeobox 2
Calculated Molecular Weight 313 aa, 34 kDa
Observed Molecular Weight 33-40 kDa
GenBank Accession NumberBC014461
Gene Symbol CDX2
Gene ID (NCBI) 1045
RRIDAB_3673070
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99626
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CDX2, also named as Homeobox protein CDX-2, is a 313 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the Caudal homeobox family. CDX2 localizes in the nucleus and is involved in the transcriptional regulation of multiple genes expression in the intestinal epithelium. The relative expression of CDX1 to CDX2 protein may be important in the anterior to posterior patterning of the intestinal epithelium and in defining patterns of proliferation and differentiation along the crypt-villus axis. Both Cdx1 and Cdx2 genes must be expressed to reduce tumorigenic potential, to increase sensitivity to apoptosis, and to reduce cell migration, suggesting that the two genes control the normal phenotype by independent pathways.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CDX2 antibody CL488-82659Download protocol
FC protocol for CL Plus 488 CDX2 antibody CL488-82659Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...