CoraLite® Plus 647-conjugated BAP31 Polyclonal antibody

• 

  FC experiment of HeLa using CL647-11200

  1X10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 647 Anti-Human BAP31 (CL647-11200) (red), or 0.8 ug CoraLite® Plus 647-conjugated Rabbit IgG control Rabbit PolyAb (CL647-30000, Clone: ) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

BAP31 Polyclonal Antibody for FC (Intra)

Cat No. CL647-11200

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

6C6 AG, BAP31, BCAP31, CDM, DXS1357E, p28, Protein CDM

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells
• Positive FC detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-11200 targets BAP31 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1668

  Product name: Recombinant human BCAP31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-246 aa of BC014323

  Sequence: MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIREYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

• Full Name: B-cell receptor-associated protein 31
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC014323
• Gene Symbol: BAP31
• Gene ID (NCBI): 10134
• RRID: AB_2934849
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51572
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

BAP31 is a chaperone protein that is abundant in the endoplasmic reticulum (ER). BAP31 plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). It also serves as a cargo receptor for the export of transmembrane proteins. BAP31 may be involved in apoptosis.