• Featured Product
  • KD/KO Validated

BAP31 Polyclonal antibody

BAP31 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 11200-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

BCAP31, 6C6 AG, 6C6-AG tumor-associated antigen, B-cell receptor-associated protein 31, BCR-associated protein 31

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HEK-293 cells, HeLa cells, MCF-7 cells, THP-1 cells, mouse brain tissue, mouse liver tissue, rat brain tissue, rat liver tisssue
Positive IP detected inA431 cells
Positive IHC detected inhuman breast cancer tissue, human colon tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11200-1-AP targets BAP31 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1668

Product name: Recombinant human BCAP31 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-246 aa of BC014323

Sequence: MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIREYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

Predict reactive species
Full Name B-cell receptor-associated protein 31
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC014323
Gene Symbol BAP31
Gene ID (NCBI) 10134
RRIDAB_2065142
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP51572
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAP31, also known as BCAP31, is a chaperone protein abundant in the endoplasmic reticulum (ER). BAP31 plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded proteins, and their targeting to the ER-associated-degradation (ERAD). CDIP1 and BAP31 interact upon ER stress to regulate the mitochondrial apoptosis pathway(PMID: 24139803). It also serves as a cargo receptor for the export of transmembrane proteins. BAP31 may be involved in apoptosis.

Protocols

Product Specific Protocols
IF protocol for BAP31 antibody 11200-1-APDownload protocol
IHC protocol for BAP31 antibody 11200-1-APDownload protocol
IP protocol for BAP31 antibody 11200-1-APDownload protocol
WB protocol for BAP31 antibody 11200-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Nat Biotechnol

Efficient proximity labeling in living cells and organisms with TurboID.

Authors - Tess C Branon
humanWB

Nat Methods

Directed evolution of APEX2 for electron microscopy and proximity labeling.

Authors - Stephanie S Lam
humanWB

Nat Commun

HDLBP binds ER-targeted mRNAs by multivalent interactions to promote protein synthesis of transmembrane and secreted proteins.

Authors - Ulrike Zinnall
humanWB

EMBO J

FUNDC1 regulates mitochondrial dynamics at the ER-mitochondrial contact site under hypoxic conditions.

Authors - Wenxian Wu
mouseWB

Mol Syst Biol

Subcellular mRNA kinetic modeling reveals nuclear retention as rate-limiting

Authors - David Steinbrecht
humanWB,IP

EMBO J

Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction.

Authors - Iwasawa Ryota R
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Boyan (Verified Customer) (11-02-2020)

This antibody labeled the ER area clearly

  • Applications: Immunofluorescence
Loading...
||
New chat Able
正在加载,请稍候...