BAP31 Polyclonal antibody

• 

  WB analysis using 11200-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11200-1-AP (BAP31 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A431 using 11200-1-AP

  IP result of anti-BAP31 (IP:11200-1-AP, 3ug; Detection:11200-1-AP 1:1000) with A431 cells lysate 3300ug.

• 

  IHC staining of human breast cancer using 11200-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11200-1-AP (BAP31 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 11200-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11200-1-AP (BAP31 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 11200-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 11200-1-AP (BAP31 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 11200-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11200-1-AP (BAP31 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 11200-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11200-1-AP (BAP31 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 11200-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BAP31 antibody (11200-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), phalloidine stains F-actin (red).

• Featured Product
• KD/KO Validated

BAP31 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11200-1-AP

Publications(26)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

BCAP31, 6C6 AG, 6C6-AG tumor-associated antigen, B-cell receptor-associated protein 31, BCR-associated protein 31

---

Tested Applications

• Positive WB detected in: A431 cells, HEK-293 cells, HeLa cells, MCF-7 cells, THP-1 cells, mouse brain tissue, mouse liver tissue, rat brain tissue, rat liver tisssue
• Positive IP detected in: A431 cells
• Positive IHC detected in: human breast cancer tissue, human colon tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 21 publications below
• IHC: See 2 publications below
• IF: See 5 publications below
• IP: See 1 publications below

Product Information

11200-1-AP targets BAP31 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1668

  Product name: Recombinant human BCAP31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-246 aa of BC014323

  Sequence: MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIREYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

• Full Name: B-cell receptor-associated protein 31
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC014323
• Gene Symbol: BAP31
• Gene ID (NCBI): 10134
• RRID: AB_2065142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51572
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAP31, also known as BCAP31, is a chaperone protein abundant in the endoplasmic reticulum (ER). BAP31 plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded proteins, and their targeting to the ER-associated-degradation (ERAD). CDIP1 and BAP31 interact upon ER stress to regulate the mitochondrial apoptosis pathway(PMID: 24139803). It also serves as a cargo receptor for the export of transmembrane proteins. BAP31 may be involved in apoptosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Biotechnol; Efficient proximity labeling in living cells and organisms with TurboID.; Authors - Tess C Branon
human	WB	Nat Methods; Directed evolution of APEX2 for electron microscopy and proximity labeling.; Authors - Stephanie S Lam
human	WB	Nat Commun; HDLBP binds ER-targeted mRNAs by multivalent interactions to promote protein synthesis of transmembrane and secreted proteins.; Authors - Ulrike Zinnall
human	WB	EMBO J; FUNDC1 regulates mitochondrial dynamics at the ER-mitochondrial contact site under hypoxic conditions.; Authors - Wenxian Wu
mouse	WB	Mol Syst Biol; Subcellular mRNA kinetic modeling reveals nuclear retention as rate-limiting; Authors - David Steinbrecht
human	WB,IP	EMBO J; Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction.; Authors - Iwasawa Ryota R ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Boyan (Verified Customer) (11-02-2020)

This antibody labeled the ER area clearly

• Applications: Immunofluorescence