• Featured Product
  • KD/KO Validated

CoraLite®532-conjugated B23/NPM1 Monoclonal antibody

B23/NPM1 Monoclonal Antibody for IF/ICC
Cat No. CL532-60096
Clone No.4F12A3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

B23, B23/NPM1, NPM1, Nucleolar phosphoprotein B23, Nucleolar protein NO38, Nucleophosmin, Numatrin

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL532-60096 targets B23/NPM1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7415

Product name: Recombinant human B23 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-293 aa of BC002398

Sequence: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKS

Predict reactive species
Full Name nucleophosmin (nucleolar phosphoprotein B23, numatrin)
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 35-38 kDa
GenBank Accession NumberBC002398
Gene Symbol NPM1
Gene ID (NCBI) 4869
RRIDAB_2919580
Conjugate CoraLite®532 Fluorescent Dye
Excitation/Emission Maxima Wavelengths537 nm / 560 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP06748
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Nucleophosmin (NPM1,B23) is a putative ribosome assembly factor with a high affinity for peptides containing nuclear localization signals (NLSs). The transport of proteins across the nuclear envelope is a selective, multistep process involving several cytoplasmic factors. Proteins must be recognized as import substrates, dock at the nuclear pore complex and translocate across the nuclear envelope in an ATP-dependent fashion. Several cytosolic and nuclear proteins that are central to this process have been identified. The 38 kDa nuclear protein nucleophosmin is involved in ribosomal assembly and rRNA transport. It is an abundant protein that is highly phosphorylated by Cdc2 kinase during mitosis.

Protocols

Product Specific Protocols
IF protocol for CL532 B23/NPM1 antibody CL532-60096Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...