Alpha E-Catenin Monoclonal antibody, PBS Only

• 

  WB analysis of NIH/3T3 using 66221-1-Ig (same clone as 66221-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66221-1-Ig (Alpha E catenin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66221-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 66221-1-Ig (same clone as 66221-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 66221-1-Ig (Alpha E catenin antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66221-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 66221-1-Ig (same clone as 66221-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 66221-1-Ig (Alpha E catenin antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66221-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 66221-1-Ig (same clone as 66221-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66221-1-Ig (Alpha E catenin antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66221-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 66221-1-Ig (same clone as 66221-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66221-1-Ig (Alpha E catenin antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66221-1-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 66221-1-Ig (same clone as 66221-1-PBS)

  1X10^6 MCF-7 cells were intracellularly stained with 0.4 ug Anti-Human Alpha E-Catenin (66221-1-Ig, Clone:2B7B8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66221-1-PBS in a different storage buffer formulation.

Alpha E-Catenin Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 66221-1-PBS

Clone No.2B7B8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

CTNNA1, 2B7B8, alpha catenin, Alpha E catenin, CAP102

---

Product Information

66221-1-PBS targets Alpha E-Catenin in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23603

  Product name: Recombinant human CTNNA1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 188-536 aa of BC031262

  Sequence: SEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI

• Full Name: catenin (cadherin-associated protein), alpha 1, 102kDa
• Calculated Molecular Weight: 906 aa, 100 kDa
• Observed Molecular Weight: 95-100 kDa
• GenBank Accession Number: BC031262
• Gene Symbol: Alpha E-Catenin
• Gene ID (NCBI): 1495
• RRID: AB_2881612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35221
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Alpha catenin is an essential component of adherens junctions that connects E-cadherin-β-catenin complexes with the actin cytoskeleton. It also recruits a range of other important proteins to developing intercellular junctions. Three alpha catenins exist in human: alpha-E-catenin, alpha-N-catenin, and alpha-T-catenin, which share substantial amino-acid sequence similarity but have distinct tissue distribution. alpha-E-catenin is ubiquitously expressed, alpha-N-catenin is restricted to neuronal tissue, and alpha-T-catenin is primarily expressed in heart tissue. Reduced levels of alpha-E-catenin protein seem to be characteristic of many different human cancers, including malignant tumours of the breast, colon, stomach, oesophagus, bladder and liver. In addition, the loss of alpha-E-catenin often correlates with the degree of tumour differentiation and metastasis.