• KD/KO Validated

CoraLite® Plus 488-conjugated ATG16L1 Polyclonal antibody

ATG16L1 Polyclonal Antibody for IF/ICC
Cat No. CL488-29445

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

IF/ICC

APG16 like 1, APG16L, ATG16L, ATG16L1, Autophagy related protein 16 1, FLJ00045, FLJ10035, FLJ10828, FLJ22677, IBD10, WDR30

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-29445 targets ATG16L1 in IF/ICC applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31318

Product name: Recombinant human ATG16L1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-230 aa of BC000061

Sequence: NKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLS

Predict reactive species
Full Name ATG16 autophagy related 16-like 1 (S. cerevisiae)
Calculated Molecular Weight 607 aa, 68 kDa
Observed Molecular Weight68-75 kDa
GenBank Accession NumberBC000061
Gene Symbol ATG16L1
Gene ID (NCBI) 55054
RRIDAB_3672839
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ676U5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Human ATG16L1 is a 607 amino acid protein (~68 kDa) comprising three major domains: the N‐terminal ATG5 binding domain (ATG5‐BD), the central coiled‐coil domain (CCD) and a predicted C‐terminal WD40‐domain. ATG16L1α and β (Atg16L1α, 63 kDa; and Atg16L1β, 71 kDa) are the major isoforms expressed in intestinal epithelium and macrophages , and all isoforms encode exon 9, which contains Thr 300. Atg16L1 mediates the cellular degradative process of autophagy and is considered a critical regulator of inflammation based on its genetic association with inflammatory bowel disease. ATG16L1 has been implicated in Crohn's disease. (PMID: 24553140, PMID: 22740627,PMID: 28685931)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ATG16L1 antibody CL488-29445Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...