Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Lamin B1 Monoclonal antibody

Lamin B1 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-66095
Clone No. 3C10G12
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

LMNB1, LMNB, LMN2, Lamin-B1, laminB1

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Lamin B1 in ?

Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66095 targets Lamin B1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20522

Product name: Recombinant human Lamin B1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 237-587 aa of BC012295

Sequence: EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

Predict reactive species
Full Name lamin B1
Calculated Molecular Weight 66 kDa
GenBank Accession NumberBC012295
Gene Symbol Lamin B1
Gene ID (NCBI) 4001
ENSEMBL Gene IDENSG00000113368
RRIDAB_2883257
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP20700
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. This protein is not suitable for samples where the nuclear envelope has been removed. The antibody is conjugated with CL488, Ex/Em 488 nm/515 nm.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Lamin B1 antibody CL488-66095Download protocol
IF protocol for CL Plus 488 Lamin B1 antibody CL488-66095Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

CL488-66095 is the CoraLite® Plus 488-conjugated Lamin B1 Monoclonal antibody (clone 3C10G12). It has 1 citation to date, published in Journal of Advanced Research (IF 17.1). The cited study investigates bioorthogonal epigenetic anchoring of heterochromatin to the nuclear lamina, with research fields spanning epigenetics, cellular senescence, and osteoarthritis.

SpeciesApplicationTitle

J Adv Res

Bioorthogonal epigenetic anchoring of heterochromatin to the nuclear lamina reverses senescence and osteoarthritis.

Authors - Xunshan Ren
Loading...
||
New chat

Able™

正在加载,请稍候...