transgelin/SM22 Recombinant monoclonal antibody

• 

  WB analysis using 83922-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83922-2-RR (transgelin/SM22 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 83922-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 83922-2-RR (transgelin/SM22 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 83922-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 83922-2-RR (transgelin/SM22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 83922-2-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using transgelin/SM22 antibody (83922-2-RR, Clone: 240864A11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 83922-2-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using transgelin/SM22 antibody (83922-2-RR, Clone: 240864A11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 83922-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83922-2-RR against Human transgelin/SM22 were performed. The affinity constant is 14.2 nM.

transgelin/SM22 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 83922-2-RR

Clone No.240864A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

SM22, transgelin, SM22-alpha, SM22-a, Protein WS3-10

---

Tested Applications

• Positive WB detected in: mouse colon tissue, rat colon tissue, mouse stomach tissue, rat stomach tissue
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83922-2-RR targets transgelin/SM22 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0764

  Product name: Recombinant human TAGLN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC004927

  Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

• Full Name: transgelin
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 19-22 kDa
• GenBank Accession Number: BC004927
• Gene Symbol: transgelin/SM22
• Gene ID (NCBI): 6876
• RRID: AB_3671502
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q01995
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The transgelin family is a protein group belonging to the 22kd actin-related calponin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, or SM22alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. This antibody was generated against full-length transgelin 1 protein. It can cross-react with other two transgenes based on the sequence similarity.