transgelin/SM22 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83922-2-RR (same clone as 83922-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83922-2-RR (transgelin/SM22 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83922-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 83922-2-RR (same clone as 83922-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 83922-2-RR (transgelin/SM22 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83922-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 83922-2-RR (same clone as 83922-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 83922-2-RR (transgelin/SM22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83922-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 83922-2-RR (same clone as 83922-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using transgelin/SM22 antibody (83922-2-RR, Clone: 240864A11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83922-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 83922-2-RR (same clone as 83922-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using transgelin/SM22 antibody (83922-2-RR, Clone: 240864A11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83922-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83922-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83922-2-RR against Human transgelin/SM22 were performed. The affinity constant is 14.2 nM.

transgelin/SM22 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 83922-2-PBS

Clone No.240864A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

SM22, transgelin, SM22-alpha, SM22-a, Protein WS3-10

---

Product Information

83922-2-PBS targets transgelin/SM22 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0764

  Product name: Recombinant human TAGLN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC004927

  Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

• Full Name: transgelin
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 19-22 kDa
• GenBank Accession Number: BC004927
• Gene Symbol: transgelin/SM22
• Gene ID (NCBI): 6876
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q01995
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The transgelin family is a protein group belonging to the 22kd actin-related calponin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, or SM22alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. This antibody was generated against full-length transgelin 1 protein. It can cross-react with other two transgenes based on the sequence similarity.