Biotin-conjugated t-Plasminogen activator/tPA Polyclonal antibody

• 

  IHC staining of mouse brain using Biotin-10147

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using Biotin-10147 (tPA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using Biotin-10147

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using Biotin-10147 (tPA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using Biotin-10147

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using Biotin-10147 (tPA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using Biotin-10147

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using Biotin-10147 (tPA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

t-Plasminogen activator/tPA Polyclonal Antibody for IHC

Cat No. Biotin-10147

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC

Synonyms

PLAT, tPA, T PA, Reteplase, EC:3.4.21.68

---

Tested Applications

• Positive IHC detected in: mouse brain tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-10147 targets t-Plasminogen activator/tPA in IHC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0200

  Product name: Recombinant human PLAT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 359-516 aa of BC002795

  Sequence: NDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP

• Full Name: plasminogen activator, tissue
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 32-35 kDa, 65 kDa
• GenBank Accession Number: BC002795
• Gene Symbol: tPA
• Gene ID (NCBI): 5327
• RRID: AB_2934328
• Conjugate: Biotin
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00750
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Plasminogen activator, tissue (PLAT, synonyms: TPA, T-PA) is a tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein (33 kDa and 32 kDa). PLAT enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding; decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. tPA has 4 isoforms produced by alternative splicing with the MW of 63 kDa, 33 kDa, 57 kDa and 44 kDa.