Tested Applications
| Positive WB detected in | recombinant protein, Transfected HEK-293 cells |
| Positive IP detected in | Transfected HEK-293T cells |
| Positive IF-P detected in | transgenic mouse brain tissue |
| Positive IF/ICC detected in | Transfected HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
50430-2-AP targets GFP tag in WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, RIP, IP-MS, ELISA applications and shows reactivity with aequorea victoria, recombinant protein samples.
| Tested Reactivity | aequorea victoria, recombinant protein |
| Cited Reactivity | mouse, rat, pig, canine, yeast, silkworm, escherichia coli |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2128 Product name: Recombinant aequorea victoria GFP tag protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-238 aa of M62653 Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK Predict reactive species |
| Full Name | GFP tag |
| Calculated Molecular Weight | 26 kDa |
| GenBank Accession Number | M62653 |
| Gene Symbol | |
| Gene ID (NCBI) | |
| RRID | AB_11042881 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42212 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Green Fluorescent Proteins (GFPs) encompass a diverse range of proteins carrying a green chromophore, originating from various species and forming different protein lineages.
Wildtype GFP consists of 238 amino acid residues (26.9 kDa). GFP was first identified in the jellyfish Aequorea victoria. It emits green light with a peak wavelength of 509 nm upon excitation by blue light at 395 nm.
When fused with other proteins, GFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.
This antibody is a rabbit polyclonal antibody, generated against the full-length eGFP protein. It exhibits reactivity towards variants of Aequorea victoria GFP, including S65T-GFP, RS-GFP, YFP, CFP, and eGFP.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GFP tag antibody 50430-2-AP | Download protocol |
| IP protocol for GFP tag antibody 50430-2-AP | Download protocol |
| WB protocol for GFP tag antibody 50430-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Circulating tumor cells shielded with extracellular vesicle-derived CD45 evade T cell attack to enable metastasis | ||
Gastroenterology PTEN deficiency facilitates exosome secretion and metastasis in cholangiocarcinoma by impairing TFEB-mediated lysosome biogenesis | ||
Nat Genet Pathogenic SPTBN1 variants cause an autosomal dominant neurodevelopmental syndrome. | ||
Mol Plant A TT1-SCE1 module integrates ubiquitination and SUMOylation to regulate heat tolerance in rice |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Gaurav (Verified Customer) (10-27-2025) | Antibodies working with a variety of cell and tissue types
|
FH Manon (Verified Customer) (09-25-2025) | It works well
|
FH Ioana (Verified Customer) (08-27-2025) | I have used this antibody for a lot of different applications and it has performed well throughout. I was particularly impressed with it's efficiency in doing IP experiments.
|
FH Yi (Verified Customer) (07-23-2025) | This GFP antibody performs reliably in both Western blot and co-IP applications. It shows strong specificity and sensitivity for GFP-tagged proteins, with clean results and minimal background for detecting and pulling down GFP fusion proteins.
|
FH Kamal (Verified Customer) (02-27-2025) | Liver lysates were subjected to SDS-PAGE and immunoblotted with GFP antibody. Multiple non-specific protein bands were detected in liver tissue lysates.
![]() |
FH Raquel (Verified Customer) (07-12-2024) | Immunofluorescence analysis in cryostat sections of 4% PFA fixed human brain organoid derived from iPSCs expressing YFP with 50430-2-AP GFP tag antibody at dilution of 1:100 (under 20x lens). (Green:YFP; Magenta: GFP tag antibody)
![]() |
FH S (Verified Customer) (05-26-2023) | Excellent
![]() |
FH PK (Verified Customer) (03-20-2023) | Very Good
![]() |
FH Stephen (Verified Customer) (08-02-2022) | HeLa cells transfected with plasmid expressing EGFP fixed with 4% PFA for 15 mins and immunostained with rabbit GFP antibody at 4 degrees incubated for 20h washed then incubated secondary alexa 594 and DAPI for 1 hour room temp imaged on wide field fluorescence microscope.
![]() |
FH A (Verified Customer) (01-04-2022) | Works for IP
|
FH Rinalda (Verified Customer) (06-21-2021) | Great product
|
FH Lana (Verified Customer) (12-22-2020) | SDS-PAGE: 15 ug/ul RIPA protein lysate, 4-12% Bis-Tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) for 2h at 80V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:2500.Secondary Ab: IRDye 800CW Goat anti-Rabbit, 1:15000.Lines of WB image: 1 – protein ladder, 2 – HEK293 whole cell lysate, negative transfection, 3 – whole cell lysate of cells transfected with eGFP.
![]() |
FH Paul (Verified Customer) (01-15-2020) | Works well for WB.
|
FH Laura (Verified Customer) (01-14-2020) | Good sensitivity for Western blot.
|
FH Aamir (Verified Customer) (01-08-2020) | Works well for WB and IF
|
FH Erica (Verified Customer) (09-26-2019) | This antibody works very well with both western blots and IP. We previously used GFP antibody from another company and it didn't work well. We then switched to Proteinntech's and the signal was very strong! Highly recommend!
|
FH Mayur (Verified Customer) (04-30-2019) | The H4 cells were transfected with pcDNA only and pcDNA EGFP . The expression of the EGFP was measured using the GFP antibody from ProteinTech. Great antibody.
![]() |


















