TOMM40 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66658-1-Ig (same clone as 66658-1-PBS)

  WB result of TOMM40 antibody (66658-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TOMM40 transfected HeLa cells. This data was developed using the same antibody clone with 66658-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66658-1-Ig (same clone as 66658-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66658-1-Ig (TOMM40 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 66658-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66658-1-Ig (same clone as 66658-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66658-1-Ig (TOMM40 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66658-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66658-1-Ig (same clone as 66658-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66658-1-Ig (TOMM40 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66658-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 66658-1-Ig (same clone as 66658-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 66658-1-Ig (TOMM40 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66658-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 66658-1-Ig (same clone as 66658-1-PBS)

  pig brain tissue, rat brain tissue, and mouse brain tissue were subjected to SDS PAGE followed by western blot with 66658-1-Ig (TOMM40 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66658-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66658-1-Ig (same clone as 66658-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66658-1-Ig (TOMM40 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66658-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 66658-1-Ig (same clone as 66658-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 66658-1-Ig (TOMM40 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66658-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66658-1-Ig (same clone as 66658-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 66658-1-Ig (TOMM40 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66658-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66658-1-Ig (same clone as 66658-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 66658-1-Ig (TOMM40 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66658-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66658-1-Ig (same clone as 66658-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 66658-1-Ig (TOMM40 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66658-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TOMM40 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66658-1-PBS

Clone No.5E2C5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

TOM40, 5E2C5, C19orf1, D19S1177E, p38.5

---

Product Information

66658-1-PBS targets TOMM40 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13065

  Product name: Recombinant human TOMM40 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-361 aa of BC017224

  Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

• Full Name: translocase of outer mitochondrial membrane 40 homolog (yeast)
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC017224
• Gene Symbol: TOMM40
• Gene ID (NCBI): 10452
• RRID: AB_2882015
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O96008
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.