• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated TMEM173/STING Polyclonal antibody

TMEM173/STING Polyclonal Antibody for IF/ICC, IF-P, FC (Intra)
Cat No. CL594-19851

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

IF/ICC, IF-P, FC (Intra)

STING, Endoplasmic reticulum interferon stimulator, ERIS, MITA, MPYS

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue
Positive IF/ICC detected inHT-29 cells, human tonsillitis tissue, HepG2 cells
Positive FC (Intra) detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL594-19851 targets TMEM173/STING in IF/ICC, IF-P, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13921

Product name: Recombinant human TMEM173 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 174-379 aa of BC047779

Sequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS

Predict reactive species
Full Name transmembrane protein 173
Calculated Molecular Weight 379 aa, 42 kDa
Observed Molecular Weight 35-40 kDa, 80 kDa
GenBank Accession NumberBC047779
Gene Symbol STING
Gene ID (NCBI) 340061
RRIDAB_2919854
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ86WV6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Stimulator of interferon genes (STING, also known as ERIS, MITA and MPYS, and encoded by TMEM173) is a transmembrane adaptor protein that facilitates innate immune signaling (PMID: 18724357). STING is widely expressed in various cell types such as endothelial cells, epithelial cells, T cells, macrophages, and dendritic cells (PMID: 26603901). It is predominantly located in the endoplasmic reticulum (ER). STING functions as a sensor of cytosolic DNA and promotes the production of type I interferons and pro-inflammatory cytokines.

Protocols

Product Specific Protocols
FC protocol for CL594 TMEM173/STING antibody CL594-19851Download protocol
IF protocol for CL594 TMEM173/STING antibody CL594-19851Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

J Neuroinflammation

The BET PROTAC inhibitor dBET6 protects against retinal degeneration and inhibits the cGAS-STING in response to light damage

Authors - Xingfei Zhu
mouse

Mol Pharm

STING-Targeted PET Imaging for Specific Detection and Therapeutic Monitoring of Myocarditis

Authors - Zhou Ye
Loading...
||
New chat Able
正在加载,请稍候...