TBR1 Monoclonal antibody

• 

  WB analysis using 66564-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66564-1-Ig (TBR1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control.

• 

  WB analysis of pig cerebellum using 66564-1-Ig

  pig cerebellum tissue were subjected to SDS PAGE followed by western blot with 66564-1-Ig (TBR1 antibody) at dilution of 1:2000 incubated at 4 degree celsius over night.

• 

  WB analysis of rat cerebellum using 66564-1-Ig

  rat cerebellum tissue were subjected to SDS PAGE followed by western blot with 66564-1-Ig (TBR1 antibody) at dilution of 1:2000 incubated at 4 degree celsius over night.

• 

  IHC staining of mouse brain using 66564-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66564-1-Ig (TBR1 antibody) at dilution of 1:200 (under 4x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 66564-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66564-1-Ig (TBR1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 66564-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66564-1-Ig (TBR1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 66564-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TBR1 antibody (66564-1-Ig, Clone: 5C3A5 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 66564-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TBR1 antibody (66564-1-Ig, Clone: 5C3A5 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TBR1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66564-1-Ig

Clone No.5C3A5

Publications(10)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

Synonyms

T box brain protein 1, T box, brain, 1, T brain 1, T-box brain protein 1, TBR 1

---

Tested Applications

• Positive WB detected in: pig brain tissue, pig cerebellum tissue, rat cerebellum tissue, rat brain tissue, mouse brain tissue, rabbit brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 4 publications below
• IF: See 5 publications below

Product Information

66564-1-Ig targets TBR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15262

  Product name: Recombinant human TBR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-196 aa of BC104844

  Sequence: MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYGHSYQGAPFYQFSSTQ

• Full Name: T-box, brain, 1
• Calculated Molecular Weight: 682 aa, 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC104844
• Gene Symbol: TBR1
• Gene ID (NCBI): 10716
• RRID: AB_2881925
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16650
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TBR1, also named T-box brain protein 1, is a 682 amino acid protein, which contains one T-box DNA-binding domain and localizes in the nucleus. TBR1 is expressed in the brain and as a transcriptional regulator is involved in developmental processes. TBR1 is required for normal brain development.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Commun; LPA signaling acts as a cell-extrinsic mechanism to initiate cilia disassembly and promote neurogenesis.; Authors - Huai-Bin Hu
mouse	IHC	EMBO J; Centrosome defects cause microcephaly by activating the 53BP1-USP28-TP53 mitotic surveillance pathway.; Authors - Thao P Phan
mouse	IF	Ann Neurol; Pathogenic MAST3 Variants in the STK Domain Are Associated with Epilepsy.; Authors - Egidio Spinelli
mouse	IF	Biochem Biophys Res Commun; Neuron-specific loss of Ppp6c induces neonatal death and decreases the number of cortical neurons and interneurons; Authors - Miki Matsuoka
human	IHC	Nat Commun; iPSC-derived models of PACS1 syndrome reveal transcriptional and functional deficits in neuron activity; Authors - Lauren Rylaarsdam
rat	IF	J Hazard Mater; Effects of nanoplastic exposure during pregnancy and lactation on neurodevelopment of rat offspring; Authors - Lei Tian