CoraLite® Plus 488-conjugated Sestrin 2 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-66297

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 Sestrin 2 antibody (CL488-66297, Clone: 1A1A4 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL488-66297

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human Sestrin 2 (CL488-66297, Clone:1A1A4) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

Sestrin 2 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-66297

Clone No.1A1A4

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

IF/ICC, FC (Intra)

Synonyms

SESN2, Sestrin2, 1A1A4, EC:1.11.1.-, Hi95

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66297 targets Sestrin 2 in IF/ICC, FC (Intra) applications and shows reactivity with human, rat, pig samples.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20638

  Product name: Recombinant human Sestrin2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 132-480 aa of BC013304

  Sequence: HMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT

• Full Name: sestrin 2
• Calculated Molecular Weight: 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC013304
• Gene Symbol: SESN2/Sestrin 2
• Gene ID (NCBI): 83667
• RRID: AB_3084231
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P58004
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Sestrins, including sestrin-1 (PA26), sestrin-2 (Hi95), and sestrin-3, are 48 to 65 kDa cystein sulfinyl reductases and they modulate peroxide signaling and antioxidant defense. These proteins selectively reduce or repair hyperoxidized forms of typical 2-Cys peroxiredoxins within eukaryotes. Expression of these proteins is regulated by p53, a tumor suppressor protein. Sestrin 2 is implicated in the regulation of cell survival, in cellular responses to different stress conditions, and also acts as a positive regulator of autophagy. Sestrin 2 is approximately a 57.6kDa protein (480 amino acids).