CoraLite® Plus 488-conjugated STAM Polyclonal antibody

• 

  FC experiment of HeLa using CL488-12434

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human STAM (CL488-12434) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

STAM Polyclonal Antibody for FC (Intra)

Cat No. CL488-12434

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

STAM 1, STAM1, STAM-1

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-12434 targets STAM in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3112

  Product name: Recombinant human STAM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 54-403 aa of BC030586

  Sequence: VNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTAYLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPGSGPTIRKPSPS

• Full Name: signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC030586
• Gene Symbol: STAM
• Gene ID (NCBI): 8027
• RRID: AB_2919053
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92783
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

STAM, also named as STAM1, belongs to the STAM family. It is involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. STAM may also play a role in T-cell development. It is involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs). Together with HRS, STAM forms ESCRT-0. STAM was originally identified as an adaptor protein involved in cytokine signaling.(PMID:20505072)