CoraLite® Plus 488-conjugated SNCB Monoclonal antibody

• 

  IF Staining of SH-SY5Y using CL488-68046

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using CoraLite® Plus 488 SNCB antibody (CL488-68046, Clone: 2B10E10 ) at dilution of 1:200.

• 

  FC experiment of SH-SY5Y using CL488-68046

  1X10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human SNCB (CL488-68046, Clone:2B10E10) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

SNCB Monoclonal Antibody for FC (Intra)

Cat No. CL488-68046

Clone No.2B10E10

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig, rabbit, chicken

Applications

FC (Intra)

Synonyms

Beta synuclein, SNCB, synuclein, beta

---

Tested Applications

• Positive FC (Intra) detected in: SH-SY5Y cells
• Positive FC detected in: SH-SY5Y cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68046 targets SNCB in FC (Intra) applications and shows reactivity with Human, mouse, rat, pig, rabbit, chicken samples.

• Tested Reactivity: Human, mouse, rat, pig, rabbit, chicken
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0772

  Product name: Recombinant human SNCB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC002902

  Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

• Full Name: synuclein, beta
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC002902
• Gene Symbol: SNCB
• Gene ID (NCBI): 6620
• RRID: AB_2923869
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16143
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.