SNCB Monoclonal antibody

• 

  WB analysis using 68046-1-Ig

  Brain tissues were subjected to SDS PAGE followed by western blot with 68046-1-Ig (SNCB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  IF Staining of mouse brain using 68046-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using SNCB antibody (68046-1-Ig, Clone: 2B10E10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

SNCB Monoclonal Antibody for WB, IF-P, ELISA

Cat No. 68046-1-Ig

Clone No.2B10E10

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig, rabbit, chicken

Applications

WB, IF-P, ELISA

Synonyms

Beta synuclein, SNCB, synuclein, beta

---

Tested Applications

• Positive WB detected in: pig brain tissue, rabbit brain, rat brain, mouse brain, chicken brain
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68046-1-Ig targets SNCB in WB, IF-P, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit, chicken samples.

• Tested Reactivity: Human, mouse, rat, pig, rabbit, chicken
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0772

  Product name: Recombinant human SNCB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC002902

  Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

• Full Name: synuclein, beta
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC002902
• Gene Symbol: SNCB
• Gene ID (NCBI): 6620
• RRID: AB_2918788
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16143
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.