FITC Plus Anti-Human SLAM/CD150 Rabbit Recombinant Antibody

SLAM/CD150 Uni-rAb® Recombinant Antibody for FC
Cat No. FITC-98220
Clone No.241800B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

SLAMF1, 241800B12, CD150, IPO 3, IPO-3

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98220 targets SLAM/CD150 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1702

Product name: Recombinant human SLAM/CD150 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 21-237 aa of NM_003037.5

Sequence: ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP

Predict reactive species
Full Name signaling lymphocytic activation molecule family member 1
Calculated Molecular Weight37kDa
GenBank Accession NumberNM_003037.5
Gene Symbol CD150
Gene ID (NCBI) 6504
Conjugate FITC Plus Fluorescent Dye
Excitation/Emission Maxima Wavelengths495 nm / 524 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13291-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Signaling lymphocytic activation molecule (SLAM, also known as SLAMF1 or CD150) is a 70-95 kDa transmembrane glycoprotein that belongs to the immunoglobulin gene superfamily. SLAM is constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation. SLAM is involved in T cell stimulation and cytokine production, and may play an important role in the regulation of immune responses to pathogens.

Protocols

Product Specific Protocols
FC protocol for FITC Plus SLAM/CD150 antibody FITC-98220Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...