Anti-Mouse SLAM/CD150 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse splenocytes using 98348-1-RR (same clone as 98348-1-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse Slamf1 Rabbit RecAb (98348-1-RR, Clone: 242631G1) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Mouse CD45R (B220) (RA3-6B2) (CL647-65139, Clone: RA3-6B2). Cells were not fixed. This data was developed using the same antibody clone with 98348-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse splenocytes using 98348-1-RR (same clone as 98348-1-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse Slamf1 Rabbit RecAb (98348-1-RR, Clone: 242631G1) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98348-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98348-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98348-1-RR against Mouse SLAM/CD150 were performed. The affinity constant is below 1 pM.

SLAM/CD150 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98348-1-PBS

Clone No.242631G1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD150, Signaling lymphocytic activation molecule, Slam, SLAM family member 1, Slamf1

---

Product Information

98348-1-PBS targets SLAM/CD150 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2787

  Product name: Recombinant Mouse SLAM/CD150 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 25-242 aa of NM_013730.4

  Sequence: TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP

• Full Name: signaling lymphocytic activation molecule family member 1
• Calculated Molecular Weight: 38 kDa
• GenBank Accession Number: NM_013730.4
• Gene Symbol: Slamf1
• Gene ID (NCBI): 27218
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9QUM4-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Signaling lymphocytic activation molecule (SLAM, also known as SLAMF1 or CD150) is a 70-95 kDa transmembrane glycoprotein that belongs to the immunoglobulin gene superfamily. SLAM is constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation. SLAM is involved in T cell stimulation and cytokine production, and may play an important role in the regulation of immune responses to pathogens.