CoraLite® Plus 488-conjugated Recoverin Polyclonal antibody

• 

  IF Staining of mouse eye using CL488-10073

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using CoraLite® Plus 488 Recoverin antibody (CL488-10073) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Recoverin Polyclonal Antibody for IF-P

Cat No. CL488-10073

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

Protein CAR, RCV1, RCVRN, recoverin

---

Tested Applications

• Positive IF-P detected in: mouse eye tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10073 targets Recoverin in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0119

  Product name: Recombinant human Recoverin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-166 aa of BC001720

  Sequence: GALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDK

• Full Name: recoverin
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC001720
• Gene Symbol: Recoverin
• Gene ID (NCBI): 5957
• RRID: AB_3672428
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35243
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Recoverin, belonging to a family of the neuronal calcium sensor (NCS) proteins, has a restricted expression in retinal photoreceptors or neurons or neuroendocrine cells. It has been suggested to play a role in light and dark adaptation by regulating rhodopsin phosphorylation. Recently, it has been found that autoantibodies against recoverin (24 kDa) have been strongly associated with cancer -associated retinopathy (CAR) syndrome, a paraneoplastic disease of the retina. But functions of recoverin in cancer cells remain unknown.